PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10028635m
Common NameCICLE_v10028635mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 387aa    MW: 42950.2 Da    PI: 6.5202
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10028635mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.73.9e-16330373548
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      +r+rr++kNRe+A rsR+RK+a++ eLe +  +L+aeN++Lk+ 
  Ciclev10028635m 330 RRQRRMIKNRESAARSRARKQAYTVELELELTQLKAENDKLKEA 373
                      69***************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-10326386IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.565328372IPR004827Basic-leucine zipper domain
CDDcd147072.47E-22330371No hitNo description
Gene3DG3DSA:1.20.5.1703.7E-15330375No hitNo description
PfamPF001702.2E-13330373IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.56E-11330383No hitNo description
PROSITE patternPS000360333348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010152Biological Processpollen maturation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MIRSVFCTGH DRNQPNCAGL TRLQEERRRM AFSDAPSVAY GGAQQQESPN DQESQSRIEK  60
SLEEQLASPL NKQGSIFSLT LDEIQLKSGK SVGSMNMDEF LANLWNNVNE NQVISQPPDN  120
NNNQNNEPIM GNKLVVETAE QAATLTRQNS FSIPILLCKK TVEEVWSEIQ KDQQPQRRCH  180
VEPPQRQPTF GEITLEEFLV KAGVVQEPAT KPCPQSHSPP IHRSNNDSNN SNNTCLGSAY  240
GMGLGPSACT MMALGFSATQ PSMGSNLLVN GYAAYPIYTA PTELVGQLAS TDSNNGDDKE  300
KSQGMMLEAV GPKGNRKRVI DGPHEVVVER RQRRMIKNRE SAARSRARKQ AYTVELELEL  360
TQLKAENDKL KEAMVHVINT FYFLQR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006424253.10.0hypothetical protein CICLE_v10028635mg
TrEMBLV4RSD50.0V4RSD5_9R
STRINGPOPTR_0009s16610.12e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.17e-55bZIP family protein